DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4aa1 and LOC103692784

DIOPT Version :9

Sequence 1:NP_611067.2 Gene:Cyp4aa1 / 36752 FlyBaseID:FBgn0034053 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_038935978.1 Gene:LOC103692784 / 103692784 RGDID:9252969 Length:337 Species:Rattus norvegicus


Alignment Length:288 Identity:91/288 - (31%)
Similarity:150/288 - (52%) Gaps:25/288 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 RFTQPWLLLDGIYHWTKMANDELNQKKRLNDFTRKMIQRRRQIQNN--------NNGNSERKCLL 284
            |..|.:|.||.:|:.|............::.||..:|:.||::.::        :...|:.|.| 
  Rat    45 RSYQLFLYLDFLYYRTADGRRFRKACDLVHSFTDAVIRERRRLLSSQGVDEFLESKTKSKSKTL- 108

  Fly   285 DHMIEI-----SESNRDFTEEDIVNEACTFMLAGQ--DSVGAAVAFTLFLLTQNPECQDRCVLEL 342
             ..|::     .|..::.::|||..||.|||...:  |:..:.:::.|:.|.::||.|:.|:.|:
  Rat   109 -DFIDVLLLAKDEHGKELSDEDIRAEADTFMFGDESHDTTASTLSWILYNLARHPEYQESCLQEV 172

  Fly   343 ATIFEDSNRAP---TMTDLHEMRYMEMCIKEALRLYPSVPLIARKLGEEVRLAK-HTLPAGSNVF 403
            ..:..|  |.|   ...||.::.::.|||||:|||:|....:.|:..:::.|.. ..:|.|:...
  Rat   173 WELLRD--REPEEIEWDDLAQLPFLTMCIKESLRLHPPAVDLLRRCTQDIVLPDGRVIPKGNICV 235

  Fly   404 ICPYATHRLAHIYPDPEKFQPERFSPENSENRHPYAFLPFSAGPRYCIGNRFAIMEIKTIVSRLL 468
            |..:..|....::||||.:.|.||.||:.:.|.|.:|:|||||||.|||..||:.|:|..|:..|
  Rat   236 ISIFGIHHNPSVWPDPEVYDPFRFDPESRQKRSPLSFIPFSAGPRNCIGQTFAMNEMKVAVALTL 300

  Fly   469 RSYQLLPVTGKTTIAATFRITLRASGGL 496
            ..::|||...:.....  .|.|||.|||
  Rat   301 LRFRLLPDDKEPRRKP--EIILRAEGGL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4aa1NP_611067.2 p450 50..475 CDD:278495 82/265 (31%)
LOC103692784XP_038935978.1 cytochrome_P450 <1..328 CDD:425388 91/288 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.