DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Prss36

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:255 Identity:90/255 - (35%)
Similarity:127/255 - (49%) Gaps:35/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 STHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCI--KGRY--ASYIRIVA 85
            |:.||||..|....:|:|||:.....   ||||||:.||..|::||||.  .|..  |..:.::.
Mouse    45 SSRIVGGSDAHPGTWPWQVSLHQGGG---HICGGSLIAPSWVLSAAHCFVTNGTLEPADELSVLL 106

  Fly    86 GQNSIADLEEQGVKVSK----LIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAV--ALEAPP 144
            |.:| .|...:|..:..    |||. .|:......|:.|:....|.:....|:|:.:  |.....
Mouse   107 GVHS-QDGPLEGAHMRSVATILIPD-NYSTVELGADLALLRLASPAKLGPSVRPVCLPRASHLFA 169

  Fly   145 SGAQAVVSGWGKRAEDDEA----LPAMLRAVELQIIEKSTCGAQY-------LTKDYTVTDEMLC 198
            .|.....:|||   :..||    ||.:|:.|||:::.::.|...|       ||  :.:...|||
Mouse   170 HGTACWATGWG---DVQEAVPLPLPWVLQEVELRLLGEAACQCLYSRPGPFNLT--FQLLPGMLC 229

  Fly   199 AGYLEGGKDTCNGDSGGPLAV-DG---VLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEE 254
            |||..|.:|||.|||||||.. ||   .|.|:.|:|.||||...|||:|:|..:..||.|
Mouse   230 AGYPAGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAPYESWIRE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 86/249 (35%)
Tryp_SPc 28..255 CDD:238113 89/252 (35%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 89/252 (35%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839454
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.