DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Prss8

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:284 Identity:98/284 - (34%)
Similarity:152/284 - (53%) Gaps:35/284 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLRLGLFL--LAALGVVIL------------TDS---ASISTHIVGGDQADIADFPYQVSVRLE 48
            |:||:||.|  |.|:.:::|            |::   |.|...|.||..|....:|:|||:   
Mouse     1 MALRVGLGLGQLEAVTILLLLGLLQSGIRADGTEASCGAVIQPRITGGGSAKPGQWPWQVSI--- 62

  Fly    49 TYMLLHICGGSIYAPRVVITAAHCI---KGRYASYIRIVAGQNSIADLEEQGVKVSKLIPHAGYN 110
            ||...|:||||:.:.:.|::||||.   ..|.|..:::.|.|......:.....|:::|.|:.|.
Mouse    63 TYDGNHVCGGSLVSNKWVVSAAHCFPREHSREAYEVKLGAHQLDSYSNDTVVHTVAQIITHSSYR 127

  Fly   111 KKTYVNDIGLIITREPLEYSALVQPIAV--ALEAPPSGAQAVVSGWGKRAED-DEALPAMLRAVE 172
            ::....||.||....|:.:|..::||.:  |..:.|:|....|:|||..|.. ....|..|:.:|
Mouse   128 EEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLE 192

  Fly   173 LQIIEKSTCGAQY-----LTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLA--VDGV--LVGVVS 228
            :.:|.:.||...|     ..:.:|:..:||||||::||||.|.|||||||:  ::|:  |.|:||
Mouse   193 VPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVS 257

  Fly   229 WGVGCGREGFPGVYTSVNSHIDWI 252
            ||..||....|||||..:::..||
Mouse   258 WGDACGAPNRPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 84/239 (35%)
Tryp_SPc 28..255 CDD:238113 86/240 (36%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 86/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.