DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:249 Identity:94/249 - (37%)
Similarity:139/249 - (55%) Gaps:17/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHC 72
            ||.||:.:     .|:....||||........|||||:   ...:.|.||||:.:.:.|::||||
Mouse     9 FLGAAVAL-----PANSDDKIVGGYTCPKHSVPYQVSL---NDGISHQCGGSLISDQWVLSAAHC 65

  Fly    73 IKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQP 135
            .|.|    :::..|:::|..||  ||.:...|:|.|..|||.|..|||.||..:.|...::.|..
Mouse    66 YKRR----LQVRLGEHNIDVLEGGEQFIDAEKIIRHPDYNKDTVDNDIMLIKLKSPAILNSQVST 126

  Fly   136 IAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAG 200
            :::......:.||.:|||||.........||:|:.:|..::..|:|...|..:   :|..|.|.|
Mouse   127 VSLPRSCASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQ---ITSNMFCLG 188

  Fly   201 YLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEE 254
            :||||||:|:||||||:..:|.:.|:||||..|...|.|||||.|.:::.||:|
Mouse   189 FLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 86/226 (38%)
Tryp_SPc 28..255 CDD:238113 89/229 (39%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 86/226 (38%)
Tryp_SPc 24..243 CDD:238113 89/229 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.