DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Prss41

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:259 Identity:83/259 - (32%)
Similarity:133/259 - (51%) Gaps:46/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQN 88
            |.:.||||.::....:|:|.|:||..:   |.||||:.:.|.|:|||||.:              
  Rat    51 IRSRIVGGIESVRGRWPWQASLRLRKF---HRCGGSLLSHRWVLTAAHCFR-------------- 98

  Fly    89 SIADLEEQGVKVSKLIPHAGY-NKKTY------------------VNDIGLIITREPLEYSALVQ 134
            ...|.::..|::.:|.....: |::.:                  .:|:.|:.....:.|:..:|
  Rat    99 KFLDPKKWTVQLGQLTSKPSFWNREAFSGRYRVKDIIINSEDKLKYHDLALLRLASSVTYNKFIQ 163

  Fly   135 PIAVALEAPPSGAQ--AVVSGWGKRAEDDEALPA--MLRAVELQIIEKSTCGA--QYLTKDYTVT 193
            |:.|...|..|..|  ..|:|||...||.:.||.  .||.|::.::..|.|..  .:.::.:.:|
  Rat   164 PVCVLPSASMSQHQPRCWVTGWGALQEDLKPLPPPYHLREVQVTVLNLSRCQELFSFASRYHLIT 228

  Fly   194 DEMLCAGYLEGGKDTCNGDSGGPLA--VDGV--LVGVVSWGVGCGREGFPGVYTSVNSHIDWIE 253
            .::.|||..:|..|||:|||||||.  :||:  .:|:||.||||||...||:||:|:.|.|||:
  Rat   229 RDVFCAGAEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSRGVGCGRPKLPGIYTNVSHHYDWIK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 80/253 (32%)
Tryp_SPc 28..255 CDD:238113 82/255 (32%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 80/253 (32%)
Tryp_SPc 55..292 CDD:238113 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.