DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG17242

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:248 Identity:63/248 - (25%)
Similarity:111/248 - (44%) Gaps:27/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GVVILTDSASISTHI--VGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGR 76
            |:::|...|.|:...  :|.:||     |:|.||::..   .|.|||.||:..:::|.|.|::..
  Fly     5 GILLLVSIAQIAADFKSIGIEQA-----PWQASVQIND---KHHCGGVIYSEDIILTIAECVRKA 61

  Fly    77 YASYIRIVAGQ------NSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQP 135
            ...:|.:..|.      .::..:|:..::|..|.|          :|:.::..|.||.....::.
  Fly    62 RLEFISVRVGSAQENAGGTVLKVEKMRLQVLGLRP----------SDVAILQLRSPLYLDGGIRA 116

  Fly   136 IAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAG 200
            |.:|......|..|.|||||:.:..:.:...:|| |:::|.::..|......|...::...:||.
  Fly   117 IPLATIPLVPGTNASVSGWGQLSAMNPSSEVLLR-VDVKIQDQLMCATNLALKGRLMSVGEICAA 180

  Fly   201 YLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIE 253
            ........|.|..||||..:..|.|::||...|.......||.::.....|||
  Fly   181 PAGEIPYACQGFVGGPLVANNRLYGILSWQSACDVLNKSSVYANIAMFKVWIE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 56/232 (24%)
Tryp_SPc 28..255 CDD:238113 59/234 (25%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 58/229 (25%)
Tryp_SPc 24..232 CDD:214473 55/226 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.