DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG17234

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:234 Identity:82/234 - (35%)
Similarity:119/234 - (50%) Gaps:26/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYI-----RIVAGQ 87
            |:||:...|...|:|||::   |...|:||||||:..:::|||||......:.:     ::.|| 
  Fly    27 IIGGEPIGIEQVPWQVSLQ---YFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAG- 87

  Fly    88 NSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPPSGAQAVVS 152
            :::.|.....|.|:.||.|..|.....:|||.::....|||:::.||||.:|...|...:.|:||
  Fly    88 SALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVS 152

  Fly   153 GWGKR---AEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSG 214
            |||..   .:.....|..|:.:.|.|....:|        ......:||||..  |:..|:||||
  Fly   153 GWGVSYILNDSTNLYPTHLQGLALHIKSIFSC--------RLFDPSLLCAGTY--GRTACHGDSG 207

  Fly   215 GPLAVDGVLVGVVSWG-VGCGREGFPGVYTSVNSHIDWI 252
            |||.|:..|||||||| .||....|   :.||....:||
  Fly   208 GPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 80/232 (34%)
Tryp_SPc 28..255 CDD:238113 82/234 (35%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 80/232 (34%)
Tryp_SPc 27..243 CDD:238113 80/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452498
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.