DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG34458

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:256 Identity:90/256 - (35%)
Similarity:137/256 - (53%) Gaps:10/256 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRLGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVI 67
            ::|.:.|||...|....|.|. .:.|:||..|....||:|||::|..   .|.||||:.:..:::
  Fly     8 VKLSILLLAVTFVHSDMDVAE-ESRIIGGQFAAPGQFPHQVSLQLNG---RHHCGGSLISDTMIV 68

  Fly    68 TAAHCIKGRYASYIRIVAGQNSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSAL 132
            |||||..|:....::.:.|.|.::....|...:::.|.|..||.::...|:.||....|:.....
  Fly    69 TAAHCTMGQNPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGA 133

  Fly   133 VQPIAVALEAPPSGA--QAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDE 195
            ||.|.:|.......|  .|::||:| ....:..||..|:..::|:..:..|.:|.:.   .:||.
  Fly   134 VQTIQLADSDSNYAADTMAMISGFG-AINQNLQLPNRLKFAQVQLWSRDYCNSQNIP---GLTDR 194

  Fly   196 MLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQA 256
            |:|||:..|...:|.|||||||.|||.|.||||||.|||.:|.|.:||.|.:...||::.|
  Fly   195 MVCAGHPSGQVSSCQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWIKQNA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 80/226 (35%)
Tryp_SPc 28..255 CDD:238113 82/228 (36%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 80/226 (35%)
Tryp_SPc 32..254 CDD:238113 82/228 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452412
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.