DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:255 Identity:81/255 - (31%)
Similarity:124/255 - (48%) Gaps:36/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAG- 86
            :::..||||..|....:|:.||:: ..|.  |.||||:...:.|:||||||..:..|.|.:..| 
Zfish    31 TLNPRIVGGVNATHGAWPWMVSLQ-GRYG--HFCGGSLINNQWVLTAAHCIVDQTPSSIIVYLGK 92

  Fly    87 -QNSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAP--PSGAQ 148
             ::.:||:......:..:|||..|:..|..|||.|:.....::|:..::||.:|.|..  |.|..
Zfish    93 WRSYVADVNSISRTIRHIIPHPSYSNITKDNDIALLQLTSTVQYTDYIKPICLADENSNFPRGTN 157

  Fly   149 AVVSGWGK---------RAEDDEAL----PAMLRAVELQIIEKSTC-----GAQYLTKDYTVTDE 195
            :.|:|||.         |.....::    |.:|:..||::...:.|     |        .:|..
Zfish   158 SWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADCNNICHG--------RITPN 214

  Fly   196 MLCAGYLEGGKDTCNGDSGGPLAVD---GVLVGVVSWGVGCGREGFPGVYTSVNSHIDWI 252
            |:|||...|||.|.:|||||||...   .|..||:|.|.||.:...|.|:..|:.:..||
Zfish   215 MICAGTRPGGKATFSGDSGGPLMTKCSVWVQAGVLSHGYGCAQPNLPEVFIRVSEYKQWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 79/249 (32%)
Tryp_SPc 28..255 CDD:238113 81/250 (32%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 79/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.