DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:229 Identity:92/229 - (40%)
Similarity:133/229 - (58%) Gaps:14/229 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNSIAD 92
            |:||.:.......||.||:...|   |.|||::..|:.|::||||.:..|  .|::|..::.::.
Zfish    24 IIGGQEVQPYSIKYQASVQYNNY---HYCGGTLIHPQWVVSAAHCWRPSY--LIKVVLSEHDLSK 83

  Fly    93 LE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQP--IAVALEAPPSGAQAVVSG 153
            :|  |:...|||.:.|..||.:|:.:||.|:...:|.|.||.:||  :.|::.|...|...:|||
Zfish    84 IEGFERVFNVSKALVHYMYNYRTFDSDIMLLKLEKPAELSATIQPAVLPVSVPALQGGTVCIVSG 148

  Fly   154 WGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLA 218
            ||........|..:||||::|||.:  |...|.   |.:||.|:|||...||||:|.|||||||.
Zfish   149 WGVTQVYSYYLSPVLRAVDVQIIPQ--CQYYYY---YRITDNMVCAGSPLGGKDSCQGDSGGPLI 208

  Fly   219 VDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWI 252
            .:|...|:||||:.|....||||||.|.::|.|:
Zfish   209 CNGYFEGIVSWGISCANAYFPGVYTKVRNYIPWM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 91/227 (40%)
Tryp_SPc 28..255 CDD:238113 92/229 (40%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 91/226 (40%)
Tryp_SPc 24..241 CDD:238113 91/226 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3835
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4156
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - oto40026
orthoMCL 1 0.900 - - OOG6_134604
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.