DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and PRSS2

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:270 Identity:99/270 - (36%)
Similarity:147/270 - (54%) Gaps:23/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLRLGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRV 65
            |:|.|.|..:||.......|    ...||||...:....|||||:. ..|   |.||||:.:.:.
Human     1 MNLLLILTFVAAAVAAPFDD----DDKIVGGYICEENSVPYQVSLN-SGY---HFCGGSLISEQW 57

  Fly    66 VITAAHCIK--------GRYASY--IRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDI 118
            |::|.||.|        ||...|  |::..|:::|..||  ||.:..:|:|.|..||.:|..|||
Human    58 VVSAGHCYKSAINSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDI 122

  Fly   119 GLIITREPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGA 183
            .||....|...::.|..|::....|.:|.::::||||.........|..|:.::..::.::.|.|
Human   123 LLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEA 187

  Fly   184 QYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSH 248
            .|..|   :|:.|.|.|:||||||:|.||||||:..:|.|.|:||||.||.::..|||||.|.::
Human   188 SYPGK---ITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNY 249

  Fly   249 IDWIEEQAEA 258
            :|||::...|
Human   250 VDWIKDTIAA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 89/236 (38%)
Tryp_SPc 28..255 CDD:238113 91/238 (38%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 89/236 (38%)
Tryp_SPc 24..256 CDD:238113 91/238 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - otm41500
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.