DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:264 Identity:99/264 - (37%)
Similarity:136/264 - (51%) Gaps:25/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLRLGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRV 65
            |:|.| |.|...|.::.::....|...||||.........|.||::..|..  |.|||::.....
Zfish     1 MNLLL-LLLCVLLEILAVSCQDVIQARIVGGYVPAPYSIKYIVSIQSATGQ--HFCGGTLINKYW 62

  Fly    66 VITAAHCIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPL- 127
            |:|||||..|.  :.:|||||..|:...|  ||..:...||||..|::.|...||.||..:.|: 
Zfish    63 VLTAAHCNIGE--ANMRIVAGDYSVGLYEGMEQFRRPHMLIPHPQYDRSTNNADIMLIKLQSPVY 125

  Fly   128 --EYSALV----QPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYL 186
              .|.:||    |...||:     |....|||||...... .:.::||.|:|.|:..:.|..   
Zfish   126 LNSYVSLVPLPRQDAMVAV-----GRLCSVSGWGFTTSTG-GISSILRTVKLPIVSTAVCNG--- 181

  Fly   187 TKDY--TVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHI 249
            |..:  .:|:.|:||||..||||.|.|||||||..:|.:.|:||||.||....:|||||:|:...
Zfish   182 TDSFNGNITENMICAGYSTGGKDACKGDSGGPLVCEGRVYGIVSWGNGCADAQYPGVYTAVSQFR 246

  Fly   250 DWIE 253
            .||:
Zfish   247 QWID 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 90/235 (38%)
Tryp_SPc 28..255 CDD:238113 92/237 (39%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 90/235 (38%)
Tryp_SPc 27..252 CDD:238113 92/237 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.