DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Elane

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:265 Identity:68/265 - (25%)
Similarity:112/265 - (42%) Gaps:43/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVIT 68
            ||....|||:.:.:.....::::.||||..|....:|:..|::....   |.||.::.|...|::
Mouse     5 RLSSRTLAAMLLALFLGGPALASEIVGGRPARPHAWPFMASLQRRGG---HFCGATLIARNFVMS 66

  Fly    69 AAHCIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSA 131
            ||||:.|.....:::|.|.:.:...|  .|...|.::..: |::....:|||.:|    .|..||
Mouse    67 AAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFEN-GFDPSQLLNDIVII----QLNGSA 126

  Fly   132 LVQPIAVALEAPPSG------AQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDY 190
            .:.......:.|..|      ...:..||| |...:...|::|:  ||.:               
Mouse   127 TINANVQVAQLPAQGQGVGDRTPCLAMGWG-RLGTNRPSPSVLQ--ELNV--------------- 173

  Fly   191 TVTDEM------LCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSW--GVGCGREGFPGVYTSVNS 247
            ||...|      :|..........|.|||||||..:.::.|:.|:  | |||...:|..:..|..
Mouse   174 TVVTNMCRRRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRG-GCGSGLYPDAFAPVAE 237

  Fly   248 HIDWI 252
            ..|||
Mouse   238 FADWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 61/240 (25%)
Tryp_SPc 28..255 CDD:238113 63/241 (26%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 61/240 (25%)
Tryp_SPc 29..245 CDD:238113 63/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.