DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Prss53

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:282 Identity:75/282 - (26%)
Similarity:117/282 - (41%) Gaps:70/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYI---RIVAG---QNSIA-DLEE 95
            ::|:|.|||.:.   :|||.||:.|...|:|||||.:....:.:   .:|.|   |..:: ..||
  Rat    47 EWPWQASVRRQG---VHICSGSLVADTWVLTAAHCFEKMATAELSSWSVVLGSLKQEGLSPGAEE 108

  Fly    96 QGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAP----PSGAQAVVSGWGK 156
            .||...:| |.| ||..:..:|:.|:....|:.::.|..|      .|    |.||....:||.:
  Rat   109 VGVAALQL-PKA-YNHYSQGSDLALLQLTHPIVHTTLCLP------QPTHHFPFGASCWATGWDQ 165

  Fly   157 RAEDDEALP------------------------------------AMLRAVELQIIEKSTCGAQY 185
            ...|.:..|                                    ..||.:.|::|.:.||...|
  Rat   166 NTSDGKYCPRHKSRESQTGSVLTVLALCSHCVSELDSTLSPLPVSRTLRNLRLRLISRPTCNCLY 230

  Fly   186 LTKDYTV-----TDEMLCAGYLEGGKDTCNGDSGGPLAV---DG--VLVGVVSWGVGCGREGFPG 240
            ......:     ...|||.|...|.:..|.||||||:..   ||  |.||::|:...|.:|..|.
  Rat   231 NRLHQRLLANPARSGMLCGGAQPGVQGPCQGDSGGPVMCREPDGHWVQVGIISFTSNCAQEDTPV 295

  Fly   241 VYTSVNSHIDWIEEQAE--AYL 260
            :.|.:.:|..|::...:  |:|
  Rat   296 LLTDMAAHSSWLQAHVDRAAFL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 72/270 (27%)
Tryp_SPc 28..255 CDD:238113 73/273 (27%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 73/273 (27%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343301
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.