DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Prss36

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:251 Identity:88/251 - (35%)
Similarity:127/251 - (50%) Gaps:27/251 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 STHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCI--KGRY--ASYIRIVA 85
            |:.||||..|....:|:|||:.   :...||||||:.||..|::||||.  .|..  |....::.
  Rat    56 SSRIVGGSDAHPGTWPWQVSLH---HGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEWSVLL 117

  Fly    86 GQNSIADLEEQGV---KVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAV--ALEAPPS 145
            |.:| .|...:|.   .|:.::....|::.....|:.|:....|.:....|:|:.:  |......
  Rat   118 GVHS-QDGPLEGAHMRSVATILVPDNYSRVELGADLALLRLASPAKLGPSVKPVCLPRASHLFAH 181

  Fly   146 GAQAVVSGWGKRAEDDE-ALPAMLRAVELQIIEKSTCGAQY-------LTKDYTVTDEMLCAGYL 202
            |.....:|||...|.|. .:|.:|:.|||:::.::.|...|       ||  ..:...||||||.
  Rat   182 GTACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLT--LQLLPGMLCAGYP 244

  Fly   203 EGGKDTCNGDSGGPLAV-DG---VLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEE 254
            ||.:|||.|||||||.. ||   .|.|:.|:|.||||...|||:|:|..:..||.|
  Rat   245 EGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAHYESWIRE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 84/245 (34%)
Tryp_SPc 28..255 CDD:238113 87/248 (35%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 87/248 (35%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.