DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and prss1.2

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001011251.1 Gene:prss1.2 / 496697 XenbaseID:XB-GENE-6083469 Length:249 Species:Xenopus tropicalis


Alignment Length:262 Identity:95/262 - (36%)
Similarity:137/262 - (52%) Gaps:21/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLRLGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRV 65
            |.|.:.|||..|....:..|.      ||||.:......|:||.....:.:   .||||:..||.
 Frog     2 MPLWILLFLAVAAAAPLDDDK------IVGGYECTPHSQPWQVYFTQNSQV---FCGGSLVTPRW 57

  Fly    66 VITAAHCIKGRYASYIRIVA--GQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREP 126
            :|:||||    |.....:||  |.:.:...|  ||.::|.....|:.|..:.|.:||.|:...:|
 Frog    58 IISAAHC----YRPPKTLVAHLGDHDLTKEEGTEQHIQVEAAYKHSSYKDEAYDHDIMLVKLAKP 118

  Fly   127 LEYSALVQPIAVALEAPPSGAQAVVSGWGK-RAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDY 190
            .:|:..||||.||...|..|.:.:|||:|. |::.....|..|:.|::.::..|:|.|....   
 Frog   119 AQYNQYVQPIPVARSCPREGTECLVSGYGNLRSDHIGEFPDRLQCVDVPVLSDSSCKASCRG--- 180

  Fly   191 TVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQ 255
            ..|:.|.|||:||||||:|..||||||..:|.|.||||||.||.:...||||..|.:::.|::..
 Frog   181 LFTENMFCAGFLEGGKDSCQVDSGGPLVCNGELYGVVSWGWGCAQRNAPGVYAKVCNYLRWVQNI 245

  Fly   256 AE 257
            .|
 Frog   246 IE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 86/229 (38%)
Tryp_SPc 28..255 CDD:238113 87/231 (38%)
prss1.2NP_001011251.1 Tryp_SPc 23..245 CDD:238113 87/231 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3316
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - otm48708
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.