DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and KLK12

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:247 Identity:86/247 - (34%)
Similarity:133/247 - (53%) Gaps:21/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITA 69
            |.:|||    :.:|..|.:.:..|..|.:......|:||.:...|.:.   |||.:...|.|:||
Human     3 LSIFLL----LCVLGLSQAATPKIFNGTECGRNSQPWQVGLFEGTSLR---CGGVLIDHRWVLTA 60

  Fly    70 AHCIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGY--NKKTYVNDIGLIITREPLEYS 130
            |||...||  ::|:  |::|::.|:  ||.......:.|.||  ...::.:|:.|:..|.|:..:
Human    61 AHCSGSRY--WVRL--GEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVT 121

  Fly   131 ALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDE 195
            :.|||:.:..:...:|.:..|||||.........|.:|:.:.|.|:..:||...|..:   :|..
Human   122 SSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGR---ITSN 183

  Fly   196 MLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWG-VG-CGREGFPGVYTSV 245
            |:|||.:. |:|.|.|||||||...|||.|:|||| || ||::|.|||||.:
Human   184 MVCAGGVP-GQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 80/225 (36%)
Tryp_SPc 28..255 CDD:238113 80/224 (36%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 80/225 (36%)
Tryp_SPc 22..236 CDD:238113 80/224 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.