DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and KLK14

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:251 Identity:90/251 - (35%)
Similarity:134/251 - (53%) Gaps:13/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAALGV--VILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAH 71
            ||.||.|  :.:|.|......|:||.....:..|:|.:: |.......:|||::.:.:.||||||
Human     4 LLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAAL-LAGPRRRFLCGGALLSGQWVITAAH 67

  Fly    72 CIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQ 134
            |  ||  ..:::..|::::...|  :|.::|.:.:.|..||.:|:.||:.|:..::|......|:
Human    68 C--GR--PILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVR 128

  Fly   135 PIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCA 199
            ||.|.......|....|||||..:......||.|:.|.:.|.....|...|   ..|:|..|:||
Human   129 PIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAY---PRTITPGMVCA 190

  Fly   200 GYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGV-GCGREGFPGVYTSVNSHIDWIEE 254
            |..:||||:|.|||||||...|.|.|:||||: .|...|:|||||::..:..||||
Human   191 GVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 79/227 (35%)
Tryp_SPc 28..255 CDD:238113 83/230 (36%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 83/230 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - otm41500
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.