DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG34130

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:221 Identity:43/221 - (19%)
Similarity:83/221 - (37%) Gaps:60/221 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ICGGSIYAPRVVITAAHCIKGRYASY----IRIVAG---QNSIADLEE----------------- 95
            :||.|..:....:|:|:|:....:..    :.:|:.   |::..|..:                 
  Fly    68 VCGASYLSALYALTSANCMHSHRSQMESLSVELVSSDSRQDNQLDSHDPPNALIRNIIVSKDWHW 132

  Fly    96 ----QGVKVSKLIPHAGYNKKTYVNDIGLIITREPL-EYSALVQPIAVALEAPPSGAQAVVSGWG 155
                ..|.|.:|......|:..||.     :...|| .|.:|                :|||...
  Fly   133 PGTFMDVAVIELTNRLRGNRNNYVT-----LCTNPLSSYKSL----------------SVVSYGA 176

  Fly   156 KRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVD 220
            ..||:       :|..|::::.:..|.:.|  .::.:.:.:.||...:...| |...:|.|:...
  Fly   177 GPAEN-------VRTEEIEVLNRMICDSAY--GNFLLRETVACAKEFKRSAD-CMFSAGCPVTAG 231

  Fly   221 GVLVGVVSWGVGCGREGFPGVYTSVN 246
            ..|.|:|:|...|.|...||::|.::
  Fly   232 DQLCGIVAWSPACKRSNLPGIFTDIH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 43/221 (19%)
Tryp_SPc 28..255 CDD:238113 43/221 (19%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 43/221 (19%)
Tryp_SPc 53..256 CDD:304450 43/218 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.