DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Gm5771

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:260 Identity:102/260 - (39%)
Similarity:146/260 - (56%) Gaps:18/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLRLGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRV 65
            ||..|.|.|:.|.....:.|.     .||||........|||||:. ..|   |.||||:...:.
Mouse     1 MSALLFLALVGAAVAFPVDDD-----KIVGGYTCRENSVPYQVSLN-SGY---HFCGGSLINDQW 56

  Fly    66 VITAAHCIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLE 128
            |::||||.|.|    |::..|:::|..||  ||.|..:|:|.|..:|:||..|||.||....|:.
Mouse    57 VVSAAHCYKTR----IQVRLGEHNIKVLEGNEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVT 117

  Fly   129 YSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVT 193
            .:|.|..:|:.....|:|.|.::||||.......:.|.:|:.::..::.::.|.|.|..|   :|
Mouse   118 LNARVATVALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYPGK---IT 179

  Fly   194 DEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQAEA 258
            ..|:|||:||||||:|.||||||:..:|.|.|:||||.||.....|||||.|.:::|||::...|
Mouse   180 GNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALADNPGVYTKVCNYVDWIQDTIAA 244

  Fly   259  258
            Mouse   245  244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 92/226 (41%)
Tryp_SPc 28..255 CDD:238113 94/228 (41%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 92/226 (41%)
Tryp_SPc 23..241 CDD:238113 94/228 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.