DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG7829

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:248 Identity:95/248 - (38%)
Similarity:135/248 - (54%) Gaps:9/248 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAH 71
            |.||.|.|.:.|  .:.....||||..||||:.||.||::|..   :|.|||||.....::||.|
  Fly     9 LLLLQASGCLSL--ESRPDPRIVGGFPADIANIPYIVSIQLYG---IHHCGGSIINNHTILTAGH 68

  Fly    72 CIKGRYASYIRIVAGQNSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPI 136
            |:.|.....:::..|..|....:.:...|:.|..|..:|.||...|||:|...:.|..|..|:.|
  Fly    69 CLNGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAI 133

  Fly   137 AVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGY 201
            .:..|....|..|.::|||.::.:.....: ||...:.|:.::.| ...|.|  ||||.||||||
  Fly   134 PINPERVAEGTYATIAGWGFKSMNGPPSDS-LRYARVPIVNQTAC-RNLLGK--TVTDRMLCAGY 194

  Fly   202 LEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEE 254
            |:||.|.|..||||||:|...|||:|||||||.....||||:.:::...|:::
  Fly   195 LKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 88/224 (39%)
Tryp_SPc 28..255 CDD:238113 89/227 (39%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 88/223 (39%)
Tryp_SPc 28..248 CDD:238113 89/227 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452492
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.