DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and intr

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:202 Identity:52/202 - (25%)
Similarity:79/202 - (39%) Gaps:42/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ICGGSIYAPRVVITAAHCIKGRY-----ASYIRIVAGQNSIADLEEQGVKVSKLIPHAGYNKKTY 114
            ||.|::.:.|:|:|:|.|.....     .|| ::.|.::.|       ..|:.||..|       
  Fly   112 ICSGALISTRLVLTSALCFPRTLRQPPPRSY-KLQASRSRI-------YSVANLITGA------- 161

  Fly   115 VNDIGLIITREPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEAL---PAMLRAVELQII 176
            :.|:.|::...||| ...|.||.:. |:|            .|..|:..:   ...||.:..::|
  Fly   162 IEDMALLLLHAPLE-DPFVHPIDLC-ESP------------LRRNDNVTMYMSQQHLRFLRTKLI 212

  Fly   177 EKSTCGAQYLTKDYT-VTDEMLCAGYLEGGK-DTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFP 239
            ..|.|...|...:.. :|..||||  |...: ..|....|..|.....|.||..:|..|...|..
  Fly   213 PNSNCKRSYAQDENAFITQTMLCA--LNSNRLVDCQTAKGDVLLHQDRLCGVDIYGQHCSDGGVN 275

  Fly   240 G-VYTSV 245
            | :|..|
  Fly   276 GELYADV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 52/202 (26%)
Tryp_SPc 28..255 CDD:238113 52/202 (26%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 52/202 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.