DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG34129

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:220 Identity:62/220 - (28%)
Similarity:88/220 - (40%) Gaps:37/220 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 CGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGL 120
            ||.:.|||.:|||:|:|          |...:||:.....:|...|:.      :::.|. ||..
  Fly    68 CGAAYYAPLLVITSANC----------IYPYRNSLEGATVEGTAFSEC------DRENYA-DIDT 115

  Fly   121 IITREPLEYSALVQPIAVA-LEAPPSG----------------AQAVVSGWGKRAEDDEALPAML 168
            |...|...|..|...:||. |..|..|                .|.||.|||....:.|...:..
  Fly   116 IQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQPKMQMVVFGWGFDNTEVEIPSSDP 180

  Fly   169 RAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGC 233
            |.|.:.||....|..::  |...:....:||...:..|. |..|.|.||.....|.||||:|..|
  Fly   181 RNVTVTIISIKECRQKF--KSPKIASTSICARQPKNPKQ-CLYDGGSPLIYGRELCGVVSFGSHC 242

  Fly   234 GREGFPGVYTSVNSHIDWIEEQAEA 258
            .....||:||::.....:|.|..|:
  Fly   243 IDTSRPGMYTNIRRVKRFITETEES 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 59/212 (28%)
Tryp_SPc 28..255 CDD:238113 60/215 (28%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 59/212 (28%)
Tryp_SPc 55..261 CDD:304450 59/212 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.