DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG5255

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:256 Identity:82/256 - (32%)
Similarity:137/256 - (53%) Gaps:20/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAALGVVILTDSAS---------ISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPR 64
            ||..|.:|:.|.||:         ....||||::|.....|||:|:: ......|.|||:|...|
  Fly     2 LLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQ-GIGSGAHSCGGAIIDER 65

  Fly    65 VVITAAHCIKGRYASYIRIVAGQNSIADLEEQGVKV---SKLIPHAGYNKKTYVNDIGLIITREP 126
            .:||||||.:||.|:..|::.|..   ||.:.|.|.   .:::.|:.|..:.|.|||.|:...|.
  Fly    66 WIITAAHCTRGRQATAFRVLTGTQ---DLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNES 127

  Fly   127 LEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYT 191
            :.:....||:.:..||...|::.:::|||..:...: :||.|:::|:..:....|.|.:  .:.|
  Fly   128 IVFDNATQPVELDHEALVPGSRLLLTGWGTLSLGGD-VPARLQSLEVNYVPFEQCRAAH--DNST 189

  Fly   192 VTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWI 252
            ..|......:.:.|:..|:|||||||..:|.||.:|:||:.|.: |:|..:.|::.:.|:|
  Fly   190 RVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCAK-GYPDAHASISYYHDFI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 74/227 (33%)
Tryp_SPc 28..255 CDD:238113 75/228 (33%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 74/227 (33%)
Tryp_SPc 30..252 CDD:238113 75/228 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.