DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG12951

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:257 Identity:88/257 - (34%)
Similarity:136/257 - (52%) Gaps:13/257 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITA 69
            |.|.|:..|.|..:..:|...:.:|.|..:.:..:|:.||:|  :|...|.|||||.:...|:||
  Fly     7 LSLSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLR--SYDGSHSCGGSIISKHFVMTA 69

  Fly    70 AHCIKGRYASYIRIVAGQNSIADLEEQGVKVSKLIPHAGYN-KKTYVNDIGLIITREPLEYSAL- 132
            |||..||.|..:.|..|..:|:.:....|.:.|:|.|..:: .:...|||.|::..||.|:..: 
  Fly    70 AHCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVS 134

  Fly   133 VQPI---AVALEAPPS--GAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTV 192
            |.|:   |:|...|.|  |.:.|:.|||.. :...::...|:.|.|:|.....|.:::  ...|.
  Fly   135 VAPVELPALAFAVPQSDAGVEGVLIGWGLN-DTYGSVQDTLQEVSLKIYSDEECTSRH--NGQTD 196

  Fly   193 TDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGV-GCGREGFPGVYTSVNSHIDWIE 253
            ....:|.|..||||..|:|||||||..:|..||:|||.: .|....:||||..|:.::|||:
  Fly   197 PKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 80/232 (34%)
Tryp_SPc 28..255 CDD:238113 82/234 (35%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 80/232 (34%)
Tryp_SPc 30..260 CDD:238113 82/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
33.010

Return to query results.
Submit another query.