DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Try10

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:254 Identity:98/254 - (38%)
Similarity:146/254 - (57%) Gaps:14/254 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAH 71
            :.:||.:|..:...:|. ...||||........|||||:. ..|   |.||||:...:.|::|||
  Rat     4 VLILALVGAAVAFPAAD-DDKIVGGYTCQENSVPYQVSLN-SGY---HFCGGSLINEQWVVSAAH 63

  Fly    72 CIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQ 134
            |.|.|    |::..|:::|..||  ||.|..:|:|.|..:.:||..|||.||....|::.::.|.
  Rat    64 CYKSR----IQVRLGEHNINVLEGNEQFVNAAKIIKHPNFIRKTLNNDIMLIKLSSPVKLNSRVA 124

  Fly   135 PIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCA 199
            .:|:.....|:|.|.::||||.........|.:|:.::..::.::.|.|.|..|   :||.|:||
  Rat   125 TVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEASYPGK---ITDNMVCA 186

  Fly   200 GYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQAEA 258
            |:||||||:|.||||||:..:|.|.|:||||.||.....|||||.|.:::|||::...|
  Rat   187 GFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 91/226 (40%)
Tryp_SPc 28..255 CDD:238113 93/228 (41%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 91/226 (40%)
Tryp_SPc 24..242 CDD:238113 93/228 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.