DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:262 Identity:80/262 - (30%)
Similarity:128/262 - (48%) Gaps:32/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ILTDSASI-------------STHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVIT 68
            :|.||:|.             ...:.||..|:..::|:|.|::...   :|.||.::.:...:||
  Rat   163 LLIDSSSFKFSGCGRRTITPGGHKVAGGQDAEEGEWPWQASLQQNN---VHRCGATLISNSWLIT 224

  Fly    69 AAHC-IKGRYASYIRIVAGQNSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSAL 132
            |||| ::.......::..|........::.||  .::.|..|:...:.|||.::....|:.|...
  Rat   225 AAHCFVRSANPKDWKVSFGFLLSKPQAQRAVK--SIVIHENYSYPAHNNDIAVVRLSSPVLYENN 287

  Fly   133 VQPIAV--ALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDY--TVT 193
            ::...:  |.:..|..:..||:|||....|.:: |.:|:...::||:..||.:   .|.|  .:|
  Rat   288 IRRACLPEATQKFPPNSDVVVTGWGTLKSDGDS-PNILQKGRVKIIDNKTCNS---GKAYGGVIT 348

  Fly   194 DEMLCAGYLEGGKDTCNGDSGGPLAVD---GV--LVGVVSWGVGCGREGFPGVYTSVNSHIDWIE 253
            ..|||||:|||..|.|.|||||||..:   |:  |.|:||||..|.....|||||.|..:.|||.
  Rat   349 PGMLCAGFLEGRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWIS 413

  Fly   254 EQ 255
            .:
  Rat   414 SK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 74/234 (32%)
Tryp_SPc 28..255 CDD:238113 76/236 (32%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 74/234 (32%)
Tryp_SPc 187..415 CDD:238113 76/236 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.