DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Sems

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:267 Identity:89/267 - (33%)
Similarity:128/267 - (47%) Gaps:31/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLRLGLFLLAALGVVI------------LTDSASI------STHIVGGDQADIADF-PYQVSVR 46
            |...|.|||||  |::|            |...|.|      .|.::||.....|.. .|.|::|
  Fly     1 MKRLLFLFLLA--GILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMR 63

  Fly    47 LETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNSIADLEEQGVK--VSKLIPHAGY 109
               |....||||::....:|:|||||.:.|.......|.|  .|:.|.|:|::  |.:.|..|.:
  Fly    64 ---YFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDG--GISRLSEKGIRRQVKRFIKSAQF 123

  Fly   110 NKKTYVNDIGLIITREPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQ 174
            ...|...|:.:::...|: ....:..:::...|...|....|||||....|||....|||.|.:.
  Fly   124 KMVTMNMDVAVVLLNRPM-VGKNIGTLSLCSTALTPGQTMDVSGWGMTNPDDEGPGHMLRTVSVP 187

  Fly   175 IIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFP 239
            :|||..|...| .:..:::|.|.||..| |.||.|..||||||..:..:.|:||:|:||....:|
  Fly   188 VIEKRICREAY-RESVSISDSMFCASVL-GKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYP 250

  Fly   240 GVYTSVN 246
            ||||.|:
  Fly   251 GVYTDVH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 76/223 (34%)
Tryp_SPc 28..255 CDD:238113 76/222 (34%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 76/223 (34%)
Tryp_SPc 44..265 CDD:238113 76/222 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.