DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG32374

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:244 Identity:73/244 - (29%)
Similarity:119/244 - (48%) Gaps:22/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQN 88
            :.|.||.|.:...:..|||.::....|.   |||..|...|.::||.||..|....| .:.||..
  Fly    70 LPTRIVNGKKIKCSRAPYQCALHYNNYF---ICGCVILNRRWILTAQHCKIGNPGRY-TVRAGST 130

  Fly    89 SIADLEEQGVK---VSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPPSGAQA- 149
            .    :.:|.:   |.|.:.|..|::.|..||:.::..:.||.....||.:    :.|.:..:. 
  Fly   131 Q----QRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKV----KLPSTRTKRF 187

  Fly   150 ----VVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCN 210
                :.||||..:.:.:.:...||.|.:..:.::.|...|......:..:|:||  ....:|||:
  Fly   188 PKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICA--KRKNRDTCS 250

  Fly   211 GDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQAEAY 259
            |||||||..:|||.|:.|:|:||....:||||.:|..:..||::.|:.|
  Fly   251 GDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIKKVAKKY 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 68/232 (29%)
Tryp_SPc 28..255 CDD:238113 70/234 (30%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 68/232 (29%)
Tryp_SPc 74..295 CDD:238113 70/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452490
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.850

Return to query results.
Submit another query.