DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG16998

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:253 Identity:78/253 - (30%)
Similarity:118/253 - (46%) Gaps:19/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITA 69
            |.|.||...|  ..|.:.|....||||.:..|...|:..|:.:...   :.|..::.....::||
  Fly     4 LALILLLICG--HKTSALSPQERIVGGVEVPIHLTPWLASITVHGN---YSCSSALITSLWLVTA 63

  Fly    70 AHCIKGRYASYIRIVAGQNSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQ 134
            .||:  :|.....:.|| ::..|...|...|..:|.|..:|.:|..|||.|:...:.......:|
  Fly    64 GHCV--QYPDSYSVRAG-STFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQ 125

  Fly   135 PIAVALEAPPS----GAQAVVSGWGK-RAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTD 194
            .:.:.|   ||    ....:|:|||. .|.|.|:.| .||...:::|.:..|...|......:||
  Fly   126 VVKLPL---PSLNILPRTLLVAGWGNPDATDSESEP-RLRGTVVKVINQRLCQRLYSHLHRPITD 186

  Fly   195 EMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWI 252
            :|:||.  ..|:|.|.||||.||...|...|:||:..||....||||||.:.:::.||
  Fly   187 DMVCAA--GAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 69/229 (30%)
Tryp_SPc 28..255 CDD:238113 71/230 (31%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 69/229 (30%)
Tryp_SPc 25..242 CDD:238113 69/228 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.