DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG13430

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:270 Identity:105/270 - (38%)
Similarity:153/270 - (56%) Gaps:31/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLLAALGVVILTDSASIST------HIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVV 66
            |.||....:|.|.:|..||      .||||.:..|..||:|||::|.|   .|.|||:|.:|.::
  Fly     6 FRLAVALWLICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGT---RHACGGTIISPNII 67

  Fly    67 ITAAHCI----KGRYASYIRIVAGQNSIADLEEQG--VKVSKLIPHAGYNKKTYV-NDIGLIITR 124
            :|||||:    |.:|  |: |.||.   :|..:.|  ::|.|:|||..::..|.: |||.::..:
  Fly    68 LTAAHCVLEYSKPQY--YV-IRAGS---SDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQ 126

  Fly   125 EPLEYSALVQPIAVALEAP---PSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYL 186
            :||.||..::||::|....   |: ||..|||||..:.........||...:.:.:::.|...|.
  Fly   127 QPLVYSQDIRPISLATSKDIIMPT-AQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYF 190

  Fly   187 TKDYTVTDEMLCAGYLEGGKDTCNGDSGGPL--AVDG--VLVGVVSWGVGCGREGFPGVYTSVNS 247
            ... |||:.|.|||...||:|:|.|||||||  ::||  .|.|:||||.||....|||:||.|::
  Fly   191 GAG-TVTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSA 254

  Fly   248 HIDWIEEQAE 257
            :.|||.:..|
  Fly   255 YDDWIAQTIE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 94/238 (39%)
Tryp_SPc 28..255 CDD:238113 96/240 (40%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 94/238 (39%)
Tryp_SPc 32..262 CDD:238113 96/240 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452512
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.