DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG32270

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:243 Identity:84/243 - (34%)
Similarity:132/243 - (54%) Gaps:20/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 STHIVGGDQADIADFPYQVSVR----LETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVA 85
            |..||||..:|:...|:.|::|    .|       ||||:..||.|:|||||:.....|...:..
  Fly    28 SPRIVGGHPSDVWHQPHMVNIRRRGNFE-------CGGSLVTPRCVLTAAHCLNDGNPSDFVVRG 85

  Fly    86 GQNSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPPSGAQAV 150
            |...::|:..... |.|::..:.|::.|..:|:.|:..::||: :::.:||::|:.:|..|:...
  Fly    86 GVTYLSDMRNSRY-VRKILMPSAYSRTTLDHDVALLQLKQPLQ-ASIAKPISLAVRSPRPGSFVR 148

  Fly   151 VSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDY-TVTDEMLCAGYLEGGKDTCNGDSG 214
            |||||.......:||..|::|.:|::.:..|...|  :.| .:|..|.||. :.|.||.|.||||
  Fly   149 VSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLY--RGYRNITSSMFCAS-VPGLKDACAGDSG 210

  Fly   215 GPLA-VDGVLVGVVSWGVG--CGREGFPGVYTSVNSHIDWIEEQAEAY 259
            ||:. .:|:||||||||..  |.....||||:.|:...|||.:....|
  Fly   211 GPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNIHRY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 80/232 (34%)
Tryp_SPc 28..255 CDD:238113 82/234 (35%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 80/232 (34%)
Tryp_SPc 31..254 CDD:238113 82/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.