DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG32833

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:283 Identity:74/283 - (26%)
Similarity:134/283 - (47%) Gaps:41/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLR-LGLFLLAALGVVILTDSAS-----------ISTHIVGGDQADIADFPYQVSVRLETYMLL 53
            |.|| |.:||  ||.|:..:|:.:           .:...:||...:|...|:..|:.::.... 
  Fly     1 MLLRSLPIFL--ALFVLSKSDTGAGEDSEEDDENDCNRTTLGGHPVNITTAPWIASISIKQKAK- 62

  Fly    54 HICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNSIAD--LEEQGVKVSKLIPHAGYNKKTYVN 116
              |.|:||....::||..|:.|.....||:..|..:.:|  :|   |.|..:..|..:..:|..:
  Fly    63 --CDGAIYKLSHIVTAGKCVDGFLNKVIRVRVGSTTRSDGVIE---VAVCNITVHEKFTGQTVFH 122

  Fly   117 DIGLIITREPLEYSALVQPIAVALEAPPSGAQAVVSGW---------GKRAEDDEALPAMLRAVE 172
            ::.::...||||.|..:|||.:|.:.|.:||:...:||         .|:..||||.  .|:..|
  Fly   123 NVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTANGWPSFRWWAMYWKKCLDDEAY--KLQKAE 185

  Fly   173 LQIIEKSTCGAQYLTKDYT---VTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCG 234
            ::::..|.|...:...:::   .||::.|..  :..|:.|:...|.|:..:|.|||:::.| ||.
  Fly   186 VKLLGPSQCTDLWARNNWSKKNFTDDLFCTE--KFAKEACSLAMGSPVVHNGKLVGIITKG-GCS 247

  Fly   235 REGFPGVYTSVNSHIDWIEEQAE 257
            .  :|.||.::..:.||:....:
  Fly   248 E--YPEVYINLIKYKDWLHNHTK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 63/238 (26%)
Tryp_SPc 28..255 CDD:238113 64/240 (27%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 64/238 (27%)
Tryp_SPc 40..262 CDD:214473 62/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.