DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Ser8

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:263 Identity:97/263 - (36%)
Similarity:139/263 - (52%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLRLGLFL-LAAL--GVVI----LTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGG 58
            |||.:..|| |.||  |.||    ...::|:...||||..:.|.|.|:|||::...   .|.|||
  Fly     1 MSLLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSG---SHFCGG 62

  Fly    59 SIYAPRVVITAAHCI-KGRYASYIRIVAGQNSIADLEEQG---VKVSKLIPHAGYNKKTYVNDIG 119
            ||.:..:::|||||: .....|.:||.||.|.    ...|   |:|:.:..|..||..:.:||||
  Fly    63 SIISNNIIVTAAHCLDTPTTVSNLRIRAGSNK----RTYGGVLVEVAAIKAHEAYNSNSKINDIG 123

  Fly   120 LIITREPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQ 184
            ::..:..|.:.:.::.|.:|...|..|:.|.:|||||.:.|..: .|.|..|:.:|:.:|.||:.
  Fly   124 VVRLKTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPS-SATLLFVDTRIVGRSQCGSS 187

  Fly   185 YLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHI 249
            .......:...|:||.  ...||.|.|||||||...|.||||||||..|....:||||.::....
  Fly   188 TYGYGSFIKATMICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELR 250

  Fly   250 DWI 252
            ||:
  Fly   251 DWV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 84/228 (37%)
Tryp_SPc 28..255 CDD:238113 85/229 (37%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 84/228 (37%)
Tryp_SPc 35..253 CDD:238113 84/227 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452506
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.860

Return to query results.
Submit another query.