DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Prss3

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001102096.1 Gene:Prss3 / 362347 RGDID:1311446 Length:246 Species:Rattus norvegicus


Alignment Length:256 Identity:98/256 - (38%)
Similarity:144/256 - (56%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLAALGVVIL--TDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITA 69
            |..||.:||.:.  .|.   ...||||........|||||:. ..|   |.||||:...:.|::|
  Rat     4 LLFLALVGVAVAFPVDD---DDKIVGGYTCQENSVPYQVSLN-SGY---HFCGGSLINDQWVVSA 61

  Fly    70 AHCIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSAL 132
            |||.|.|    |::..|:::|..||  ||.|..:|:|.|..:|.:...|||.||....|::.:|.
  Rat    62 AHCYKTR----IQVRLGEHNINVLEGDEQFVNAAKIIKHPNFNARNLNNDIMLIKLSSPVKLNAR 122

  Fly   133 VQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEML 197
            |..:|:.....|:|.|.::||||.........|.:|:.::..::.::.|.|.|..|   :|:.|:
  Rat   123 VATVALPSSCAPAGTQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEASYPGK---ITNNMI 184

  Fly   198 CAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQAEA 258
            |.|:||||||:|.||||||:..:|.|.|:||||.||..:..|||||.|.:::|||::...|
  Rat   185 CVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQDTIAA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 89/226 (39%)
Tryp_SPc 28..255 CDD:238113 91/228 (40%)
Prss3NP_001102096.1 Tryp_SPc 23..239 CDD:214473 89/226 (39%)
Tryp_SPc 24..242 CDD:238113 91/228 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.