DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and PRSS41

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:261 Identity:79/261 - (30%)
Similarity:119/261 - (45%) Gaps:59/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNSIAD 92
            :.||.::....:|:|.|:||..   .|.||||:.:.|.|::||||.:..|..             
Human    71 VAGGVESARGRWPWQASLRLRR---RHRCGGSLLSRRWVLSAAHCFQKHYYP------------- 119

  Fly    93 LEEQGVKVSKLIPH-AGYNKKTYV-------------------NDIGLIITREPLEYSALVQPIA 137
             .|..|::.:|... ..:|.:.|.                   |||.|:.....:.|:|.:|||.
Human   120 -SEWTVQLGELTSRPTPWNLRAYSSRYKVQDIIVNPDALGVLRNDIALLRLASSVTYNAYIQPIC 183

  Fly   138 VA------LEAPPSGAQAVVSGWGKRAEDDEALPA--MLRAVELQIIEKSTCGAQYLTKDYT--- 191
            :.      :..|    ...|:|||..:.....||.  .||..::.|:..:.|  .||.:..:   
Human   184 IESSTFNFVHRP----DCWVTGWGLISPSGTPLPPPYNLREAQVTILNNTRC--NYLFEQPSSRS 242

  Fly   192 -VTDEMLCAGYLEGGKDTCNGDSGGPLAV--DGV--LVGVVSWGVGCGREGFPGVYTSVNSHIDW 251
             :.|.|.|||..:|..|||.|||||||..  ||:  .||:||||:.||:...|||||:::.:..|
Human   243 MIWDSMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCGQPNRPGVYTNISVYFHW 307

  Fly   252 I 252
            |
Human   308 I 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 77/259 (30%)
Tryp_SPc 28..255 CDD:238113 79/261 (30%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.