DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and KLK3

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001639.1 Gene:KLK3 / 354 HGNCID:6364 Length:261 Species:Homo sapiens


Alignment Length:261 Identity:88/261 - (33%)
Similarity:126/261 - (48%) Gaps:31/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VVILTDSAS-------ISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHC 72
            ||.||.|.:       |.:.||||.:.:....|:||.|......   :|||.:..|:.|:|||||
Human     5 VVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRA---VCGGVLVHPQWVLTAAHC 66

  Fly    73 IKGRYASYIRIVAGQNSIADLEEQG--VKVSKLIPHAGYNKKTYVN-----------DIGLIITR 124
            |:.:..    |:.|::|:...|:.|  .:||...||..|:.....|           |:.|:...
Human    67 IRNKSV----ILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLS 127

  Fly   125 EPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKD 189
            ||.|.:..|:.:.:..:.|..|.....||||....::...|..|:.|:|.:|....|...:..| 
Human   128 EPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQK- 191

  Fly   190 YTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWG-VGCGREGFPGVYTSVNSHIDWIE 253
              ||..|||||...|||.||:|||||||..:|||.|:.||| ..|.....|.:||.|..:..||:
Human   192 --VTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIK 254

  Fly   254 E 254
            :
Human   255 D 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 80/238 (34%)
Tryp_SPc 28..255 CDD:238113 82/241 (34%)
KLK3NP_001639.1 Tryp_SPc 25..256 CDD:238113 82/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41500
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.