DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Prss21

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:266 Identity:90/266 - (33%)
Similarity:133/266 - (50%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIK------------G 75
            :|.:.||||::|::..:|:|.|:|:...   |:||.::...|.|:|||||.:            |
  Rat    53 TIPSRIVGGEEAELGRWPWQGSLRVWGN---HLCGATLLNRRWVLTAAHCFQKDNDPFDWTVQFG 114

  Fly    76 RYAS-----YIRIVAGQNSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQP 135
            ...|     .::..:.:..|.|: ....|.::..||          ||.|:....|:.||..:||
  Rat   115 ELTSRPSLWNLQAYSNRYQIEDI-FLSPKYTEQFPH----------DIALLKLSSPVTYSNFIQP 168

  Fly   136 IAVALEAPPSGAQAV---VSGWGKRAEDDE-ALPAMLRAVELQIIEKSTCGAQYLTKDYTVT--D 194
            |.: |.:....|...   |:|||...||:. .||..|:.|::.||..:.|...:...|:.:.  .
  Rat   169 ICL-LNSTYKFANRTDCWVTGWGAIGEDESLPLPNNLQEVQVAIINNTMCNHLFKKPDFRINIWG 232

  Fly   195 EMLCAGYLEGGKDTC---------NGDSGGPLAV--DGV--LVGVVSWGVGCGREGFPGVYTSVN 246
            :|:|||..|||||.|         .|||||||..  |.|  .|||||||:||||...|||||:::
  Rat   233 DMVCAGSPEGGKDACFAKLTYAAPQGDSGGPLVCNQDTVWYQVGVVSWGIGCGRPNRPGVYTNIS 297

  Fly   247 SHIDWI 252
            .|.:||
  Rat   298 HHYNWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 87/260 (33%)
Tryp_SPc 28..255 CDD:238113 89/261 (34%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 87/260 (33%)
Tryp_SPc 58..304 CDD:238113 89/261 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.