DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG18477

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster


Alignment Length:250 Identity:80/250 - (32%)
Similarity:131/250 - (52%) Gaps:29/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNSIADLEEQ-- 96
            |..|:.|:.|:: |:.....::.||::.||.|||||....:...||.:.:.||:...:...||  
  Fly   113 AQEAEVPWMVAL-LDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLP 176

  Fly    97 --GVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPPS--GAQAVVSGWGKR 157
              .|.:..::.|.|:|.:...|::.|:..|..|..|..:.||.:. .||.:  .::.:.:||||.
  Fly   177 SVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMP-SAPKNFDFSRCIFTGWGKN 240

  Fly   158 AEDDEALPAMLRAVELQIIEKSTCGAQ---YLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAV 219
            :.||.:...:|:.:.|.::::.||..|   |...|:.:.:.::|||. |.|||:|.||.|.|||.
  Fly   241 SFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGG-EPGKDSCEGDGGSPLAC 304

  Fly   220 ---DG----VLVGVVSWGVGCGREGFPGVYTSVNSHIDWI----------EEQAE 257
               |.    .|.|:|::||.||..|.|.|||:|.:.|:||          ||:.|
  Fly   305 AIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVNMPLPEEREE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 75/233 (32%)
Tryp_SPc 28..255 CDD:238113 78/246 (32%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 75/233 (32%)
Tryp_SPc 113..344 CDD:238113 75/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.