DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and PRSS53

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:292 Identity:81/292 - (27%)
Similarity:116/292 - (39%) Gaps:82/292 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIR---IVAGQNSIADL----EE 95
            ::|:|.|||.:.   .|||.||:.|...|:|||||.:...|:.:.   :|.|......|    ||
Human    47 EWPWQASVRRQG---AHICSGSLVADTWVLTAAHCFEKAAATELNSWSVVLGSLQREGLSPGAEE 108

  Fly    96 QGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAP----PSGAQAVVSGWGK 156
            .||...:| |.| ||..:..:|:.|:....|..::.|..|      .|    |.||....:||.:
Human   109 VGVAALQL-PRA-YNHYSQGSDLALLQLAHPTTHTPLCLP------QPAHRFPFGASCWATGWDQ 165

  Fly   157 RAED---------DEAL-----------------------------------PAMLRAVELQIIE 177
            ...|         .|||                                   |..||.:.|::|.
Human   166 DTSDGKCWPRLKLGEALCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLIS 230

  Fly   178 KSTCGAQY-------LTKDYTVTDEMLCAGYLEGGKDTCNGDSGGP---LAVDG--VLVGVVSWG 230
            :.||...|       |:.  .....|||.|...|.:..|.||||||   |..||  |..|::|:.
Human   231 RPTCNCIYNQLHQRHLSN--PARPGMLCGGPQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISFA 293

  Fly   231 VGCGREGFPGVYTSVNSHIDWIEE--QAEAYL 260
            ..|.:|..|.:.|:..:|..|::.  |..|:|
Human   294 SSCAQEDAPVLLTNTAAHSSWLQARVQGAAFL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 77/280 (28%)
Tryp_SPc 28..255 CDD:238113 78/285 (27%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 78/281 (28%)
Tryp_SPc 43..314 CDD:214473 77/279 (28%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.