DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Prss53

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:239 Identity:73/239 - (30%)
Similarity:110/239 - (46%) Gaps:39/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIK----GRYASYIRIVA-----GQNSIADL 93
            ::|:|.|||.:.   :|||.||:.|...|:|||||.:    ...:|:..::.     ||:..|  
Mouse    47 EWPWQASVRRQG---VHICSGSLVADTWVLTAAHCFEKMATAELSSWSVVLGSLKQEGQSPGA-- 106

  Fly    94 EEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAP----PSGAQAVVSGW 154
            ||.||...:| |.| ||..:..:|:.|:....|...:.|..|      .|    |.||....:||
Mouse   107 EEVGVAALQL-PKA-YNHYSQGSDLALLQLTHPTVQTTLCLP------QPTYHFPFGASCWATGW 163

  Fly   155 GKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDE-----MLCAGYLEGGKDTCNGDSG 214
            .:...|   :...||.:.|::|.:.||...|......:...     |||.|...|.:..|.||||
Mouse   164 DQNTSD---VSRTLRNLRLRLISRPTCNCLYNRLHQRLLSNPARPGMLCGGAQPGEQGPCQGDSG 225

  Fly   215 GPLAV---DG--VLVGVVSWGVGCGREGFPGVYTSVNSHIDWIE 253
            ||:..   ||  |.||::|:...|.:|..|.:.|.:..|..|::
Mouse   226 GPVMCREPDGHWVQVGIISFTSKCAQEDTPVLLTDMAVHSSWLQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 72/236 (31%)
Tryp_SPc 28..255 CDD:238113 73/239 (31%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46
Tryp_SPc 45..271 CDD:238113 73/239 (31%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.