DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CLIPC1

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_552698.3 Gene:CLIPC1 / 3291827 VectorBaseID:AGAP008835 Length:389 Species:Anopheles gambiae


Alignment Length:247 Identity:80/247 - (32%)
Similarity:124/247 - (50%) Gaps:25/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGDQADIADFPYQVSVRL-ETYMLLHICGGSIYAPRVVITAAHCIKGRY---ASYIRIVAGQN 88
            ||.|:.|...:||:...:.. |...:.::||||:.:.|.::||.||:....   |:.:|:  |:.
Mosquito   143 IVDGELAKAREFPHMALIGFGEAPEIRYLCGGSLVSDRFILTAGHCLTSTNFGPATIVRL--GEL 205

  Fly    89 SIADLEEQG----VKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPPSGAQA 149
            |:|...::.    ..:::.|||..|.:.::.|||.||.....:.:|...:||.:.|:|.....:|
Mosquito   206 SLASSTDEAFPEDYDIAERIPHPEYKQTSHYNDIALIKLNRKVIFSPYARPICLPLQAAIPQKRA 270

  Fly   150 VVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQY-----LTKDYTVTDEMLCAGYLEGGKDTC 209
            :.:|||......|...|:|: |.|.:.....|..|:     |......|.: ||||.....||||
Mosquito   271 IATGWGAIGFGLEQSSALLK-VTLDMFRFEECKDQFEPTRKLRTGLNATTQ-LCAGSRNSTKDTC 333

  Fly   210 NGDSGGPLAVDG--------VLVGVVSWGVGCGREGFPGVYTSVNSHIDWIE 253
            .|||||||.|..        .::||.|:|..||..|.|.|||:|.|::.|||
Mosquito   334 QGDSGGPLQVYNDANVYCTYTIIGVTSFGQNCGLAGVPAVYTTVYSYLSWIE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 77/244 (32%)
Tryp_SPc 28..255 CDD:238113 80/247 (32%)
CLIPC1XP_552698.3 CLIP 39..79 CDD:197829
Tryp_SPc 143..386 CDD:238113 80/247 (32%)
Tryp_SPc 143..384 CDD:214473 77/244 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.