DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and AgaP_AGAP005689

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_556335.3 Gene:AgaP_AGAP005689 / 3290022 VectorBaseID:AGAP005689 Length:300 Species:Anopheles gambiae


Alignment Length:244 Identity:73/244 - (29%)
Similarity:122/244 - (50%) Gaps:22/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 STHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASY----IRIVA 85
            |..|..|.:|....||:|:::..|......:||||:.....::|||||:....::.    :.|:.
Mosquito    53 SHRITNGQEATPGQFPFQIALISEFASGNGLCGGSVLTRNFILTAAHCVVSGASTLASGGVAIMG 117

  Fly    86 GQN-SIADLEEQGVK--VSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPP--- 144
            ..| :|.:..:|.::  .|.:..|..|:..|..|||..:....|:.::..:|||.:...:..   
Mosquito   118 AHNRNIQESTQQRIRFATSGIRRHPSYSSSTLRNDIATVRLNSPMTFTTRIQPIRLPGRSDTRQF 182

  Fly   145 SGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLC-AGYLEGGKDT 208
            .|....|||:|:.::...|..|::|.....::..:.|.|::   ..||.::.:| :|  .||:.:
Mosquito   183 GGFTGTVSGFGRTSDASSATSAVVRFTTNPVMTNTDCIARW---GSTVVNQHVCLSG--AGGRSS 242

  Fly   209 CNGDSGGPLAVDG---VLVGVVSWGV--GCGREGFPGVYTSVNSHIDWI 252
            |||||||||.|..   :.:||||:|.  ||. .|.|.||..|...:|||
Mosquito   243 CNGDSGGPLTVQSGGTMQIGVVSFGSVNGCA-IGMPSVYARVTFFLDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 70/240 (29%)
Tryp_SPc 28..255 CDD:238113 72/241 (30%)
AgaP_AGAP005689XP_556335.3 Tryp_SPc 55..290 CDD:214473 70/240 (29%)
Tryp_SPc 56..290 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.