DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and sphe

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:260 Identity:73/260 - (28%)
Similarity:126/260 - (48%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITA 69
            |||..|.|:|:      ......|:||:.||.....:..|:|::.   .|:|||||.:...::|.
  Fly     9 LGLIGLTAVGM------CHAQGRIMGGEDADATATTFTASLRVDN---AHVCGGSILSQTKILTT 64

  Fly    70 AHCI--KGRYASYIRI---VAGQNSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEY 129
            |||:  .|:.....|:   |...|..|.  .:.|.|..:..|..|....  |::.:|.....|.|
  Fly    65 AHCVHRDGKLIDASRLACRVGSTNQYAG--GKIVNVESVAVHPDYYNLN--NNLAVITLSSELTY 125

  Fly   130 SALVQ--PIAVALEA-PPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYT 191
            :..:.  |:..:.|| |..|::.:|:|||:.::...:.  .:|.:.|::..::||...|...|  
  Fly   126 TDRITAIPLVASGEALPAEGSEVIVAGWGRTSDGTNSY--KIRQISLKVAPEATCLDAYSDHD-- 186

  Fly   192 VTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVG-CGREGFPGVYTSVNSHIDWIEEQ 255
              ::..|..: |..:.||:||.||.......|:|:.::.|| ||.. :|.|:..::|:.|||:||
  Fly   187 --EQSFCLAH-ELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSR-YPDVFVRLSSYADWIQEQ 247

  Fly   256  255
              Fly   248  247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 63/233 (27%)
Tryp_SPc 28..255 CDD:238113 65/235 (28%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 60/219 (27%)
Tryp_SPc 42..244 CDD:214473 58/216 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.