DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG33160

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:257 Identity:82/257 - (31%)
Similarity:125/257 - (48%) Gaps:12/257 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLAALG----VVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVI 67
            |||:..||    |....||..|...|:||..:.|.:..|.|.|....    .:||||:..||.||
  Fly     9 LFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTSE----ELCGGSLVKPRWVI 69

  Fly    68 TAAHCIKGRYASYIRIVAGQNSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSAL 132
            |||||:..:..:..:|..|.::.|........|..:.....:|:||...|:..:.....: ..|.
  Fly    70 TAAHCVYNKNKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDM-IGAN 133

  Fly   133 VQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEML 197
            ::.|.:|.::.|:.|...|||||....|.......:.:|.:.:..:::|.:.: ...:.:|..|:
  Fly   134 IETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAF-RGIHRITRSMV 197

  Fly   198 CAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQAEAY 259
            ||..|. .||:|:|||||||...|.|.|:||:|.||. ...||:||||....||.:...|.:
  Fly   198 CAARLY-KKDSCDGDSGGPLVYRGQLAGIVSFGYGCA-SALPGIYTSVPEIRDWFQRVVEQH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 71/224 (32%)
Tryp_SPc 28..255 CDD:238113 72/226 (32%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 70/223 (31%)
Tryp_SPc 34..253 CDD:238113 72/226 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.