DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG33159

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:266 Identity:92/266 - (34%)
Similarity:141/266 - (53%) Gaps:29/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLRLGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRV 65
            :.||| |:.|..|.:|:  .|:|..|.||||.:..|::.||.|.:|...|.   |||||:.:.|.
  Fly     2 VGLRL-LWWLCHLALVL--PSSSSKTRIVGGKETTISEVPYLVYLRQNGYF---ICGGSLISSRA 60

  Fly    66 VITAAHCIKGRYASYIRIVAGQNSIADLEEQGVKVSKLI---PHAGYNKKTYVNDIGLIITREPL 127
            |::||||:.|.......:.||.:.   |:::...|..::   ....|:...:..|:.|:    .|
  Fly    61 VLSAAHCVYGSQPEGFTVHAGASR---LDQEAPVVRNVVMFHTSPSYSATNFDMDVALL----QL 118

  Fly   128 EYSALVQPIAVA----LEAPPSG-AQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLT 187
            :...::.|..||    ...||.| |.|.:||||...|::......:|...::::..:.|...|  
  Fly   119 QEVVVLTPGKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISY-- 181

  Fly   188 KDY-TVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNS---H 248
            ..| .::|.||||. :.|.:|:|:|||||||...|.:.|:||||.||.|..||||||:|.|   |
  Fly   182 SGYGQLSDSMLCAA-VRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERVH 245

  Fly   249 IDWIEE 254
             ::||:
  Fly   246 -EFIEQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 80/236 (34%)
Tryp_SPc 28..255 CDD:238113 82/239 (34%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 78/228 (34%)
Tryp_SPc 26..251 CDD:238113 82/239 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.