DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG31681

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:261 Identity:95/261 - (36%)
Similarity:135/261 - (51%) Gaps:19/261 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLRLGLFLLAAL-GVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPR 64
            |.|||.|.:|.:: |:............||||....|...|:||||:..:   ||.|||.||:.|
  Fly     1 MCLRLLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNS---LHCCGGVIYSDR 62

  Fly    65 VVITAAHCIKGRYASYIRIVAGQNSIADLEEQGVKVSKLIPHAGYNKKTY-VNDIGLIITREPLE 128
            .::|||||:.....:.:.:.|| :|......|.:||.|.|.|..|..|.| ..||.::|...||.
  Fly    63 AILTAAHCLSNVTVTDLSVRAG-SSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLR 126

  Fly   129 YSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVT 193
            ....|:.|.:|.:.|.:|...:.||||...|:...|..:|:.|.:.|:.::.|...|  |...:|
  Fly   127 LGGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAY--KHVNIT 189

  Fly   194 DEMLCAGYLEGGK-DTCNGDSGGPL--AVDG---VLVGVVSWGVGCGREGFPGVYTSVNSHIDWI 252
            .:|:||   :|.: |||.|||||||  ...|   .|:|:||||.|||..  ||||..:....:||
  Fly   190 IDMICA---DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN--PGVYEDIAFFHNWI 249

  Fly   253 E 253
            :
  Fly   250 K 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 86/231 (37%)
Tryp_SPc 28..255 CDD:238113 88/233 (38%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 86/231 (37%)
Tryp_SPc 29..250 CDD:238113 87/231 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452499
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.