DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Prtn3

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:239 Identity:66/239 - (27%)
Similarity:118/239 - (49%) Gaps:31/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 STHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNS 89
            ::.||||.:|.....||..|::|......|.|||::..||.|:|||||::......:.:|.|.:.
  Rat   195 ASKIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLTAAHCLQDISWQLVTVVLGAHD 259

  Fly    90 I--ADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVAL-----EAPPSGA 147
            :  ::.|:|...::::..: .||.:..:||:.|:....|   ::|.:.:|||.     ::...|.
  Rat   260 LLSSEPEQQKFTITQVFEN-NYNPEETLNDVLLLQLNRP---ASLGKQVAVASLPQQDQSLSQGT 320

  Fly   148 QAVVSGWGK---RAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTC 209
            |.:..|||:   ||    ..|.:|..:.:.::       .:|.:::.|     |..........|
  Rat   321 QCLAMGWGRLGTRA----PTPRVLHELNVTVV-------TFLCREHNV-----CTLVPRRAAGIC 369

  Fly   210 NGDSGGPLAVDGVLVGVVSWGV-GCGREGFPGVYTSVNSHIDWI 252
            .|||||||..:|:|.||.|:.: .|....||..:..|:.:::||
  Rat   370 FGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVNWI 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 64/235 (27%)
Tryp_SPc 28..255 CDD:238113 66/236 (28%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 66/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.