DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and LOC312273

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:244 Identity:90/244 - (36%)
Similarity:138/244 - (56%) Gaps:14/244 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRY 77
            ||.|....:......||||........|||||:...:    ||||||:...:.|::||||    |
  Rat    10 LGTVAAFPTEDNDDRIVGGYTCQEHSVPYQVSLNAGS----HICGGSLITDQWVLSAAHC----Y 66

  Fly    78 ASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVAL 140
            ...:::..|:::|.::|  ||.:..:|:|.|..|:|.|..|||.||..:.|...::.|..|.:..
  Rat    67 HPQLQVRLGEHNIYEIEGAEQFIDAAKMILHPDYDKWTVDNDIMLIKLKSPATLNSKVSTIPLPQ 131

  Fly   141 EAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGG 205
            ..|.:|.:.:|||||......|: |::|:.::..::..|.|...|..:   :|:.|.|.|:||||
  Rat   132 YCPTAGTECLVSGWGVLKFGFES-PSVLQCLDAPVLSDSVCHKAYPRQ---ITNNMFCLGFLEGG 192

  Fly   206 KDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEE 254
            ||:|..|||||:..:|.:.|:||||.||..||.|||||.|.::::||.:
  Rat   193 KDSCQYDSGGPVVCNGEVQGIVSWGDGCALEGKPGVYTKVCNYLNWIHQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 85/226 (38%)
Tryp_SPc 28..255 CDD:238113 87/229 (38%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 87/229 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.