DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG3795

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:250 Identity:79/250 - (31%)
Similarity:120/250 - (48%) Gaps:34/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGDQADIADF-PYQVSVRL----ETYMLLHICGGSIYAPRVVITAAHCI----KGRYASYIRI 83
            :.||.:.|..|. .|.||:|:    :.:...|.|.|:|::.|.::|||||:    :...|..:.:
  Fly    46 VTGGYRPDTNDLVKYTVSLRMGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMV 110

  Fly    84 VAG--QNSIADLEEQGVKVSKLIPHAGYNK-KTYVNDIGLIITREPLEYSALVQPIAVALEAPPS 145
            |||  :..:.....|.::..:|:||..|.| |:...|||||:....|.....|..|.:..:.|.:
  Fly   111 VAGTPRRLLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVA 175

  Fly   146 GAQAVVSGWGKRAE----DDEALPAMLRAVELQIIEK----STCGAQYLTKDYTVTDEMLCAG-Y 201
            ||...:.|||...:    .|||:...::.:.....||    |..|             ||||. .
  Fly   176 GAPCSIVGWGTVIQFGPLPDEAINGDMQILPDTFCEKLLGWSNAG-------------MLCANDK 227

  Fly   202 LEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQA 256
            .:...|:|.|||||||..|.::.|:||:|:|||.....|:||.|....|||.|.:
  Fly   228 HDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDSAGIYTDVYHFRDWITENS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 76/244 (31%)
Tryp_SPc 28..255 CDD:238113 78/247 (32%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 74/233 (32%)
Tryp_SPc 60..278 CDD:214473 72/230 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.